Loading...
Statistics
Advertisement

Vitor Torres
www.vgatorres.com/

Vgatorres.com

Advertisement
Conversion Technology Metas Server
Vgatorres.com is hosted in United States / Scottsdale . Vgatorres.com uses HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Html, Html5, Number of used javascripts: 17. First javascripts: Jquery.js, Jquery-migrate.min.js, External-tracking.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 2. Its server type is: Apache/2.4.23. Its CMS is: Wordpress.

Technologies in use by Vgatorres.com

Technology

Number of occurences: 7
  • CSS
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 17
  • jquery.js
  • jquery-migrate.min.js
  • external-tracking.min.js
  • comment-reply.min.js
  • jquery.mousewheel.min.js
  • modernizr.custom.js
  • viewport-units-buggyfill.js
  • viewport-units-buggyfill.hacks.js
  • jquery.magnific-popup.min.js
  • slick.min.js
  • fancySelect.js
  • misc.js
  • wp-embed.min.js
  • imagesloaded.pkgd.min.js
  • packery.pkgd.min.js
  • bt_grid_tweak.js
  • bt_grid.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4.23

Powered by

  • PHP/5.5.37

CDN

Number of occurences: 2
  • Maxcdn
  • OSS CDN

Used plugins, modules

Number of plugins and modules: 2
  • google analyticator
  • ad hoc portfolio

Google Analytics ID

  • UA-XXXXXXXX-X

Conversion rate optimization
visitors Clickable call number Founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Vgatorres.com

SSL certificate

    • name: /C=US/ST=Arizona/L=Scottsdale/O=Special Domain Services, LLC./CN=*.prod.iad2.secureserver.net
    • subject:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: Special Domain Services, LLC.
      • CN: *.prod.iad2.secureserver.net
    • hash: c6d19db4
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: Starfield Technologies, Inc.
      • OU: http://certs.starfieldtech.com/repository/
      • CN: Starfield Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 16522704787133396204
    • validFrom: 150120175838Z
    • validTo: 180120175838Z
    • validFrom_time_t: 1421776718
    • validTo_time_t: 1516471118
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.starfieldtech.com/sfig2s2-0.crl
      • certificatePolicies: Policy: 2.16.840.1.114414.1.7.23.2 CPS: http://certificates.starfieldtech.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.starfieldtech.com/ CA Issuers - URI:http://certificates.starfieldtech.com/repository/sfig2.crt
      • authorityKeyIdentifier: keyid:25:45:81:68:50:26:38:3D:3B:2D:2C:BE:CD:6A:D9:B6:3D:B3:66:63
      • subjectAltName: DNS:*.prod.iad2.secureserver.net, DNS:prod.iad2.secureserver.net
      • subjectKeyIdentifier: C6:B5:9A:C6:B2:84:51:1C:E4:8A:55:F1:9F:2B:9A:45:39:FB:F9:C8

Meta - Vgatorres.com

Number of occurences: 8
  • Name:
    Content: http://vgatorres.com/wp-content/uploads/2015/12/as.png
  • Name: viewport
    Content: width=device-width, initial-scale=1, maximum-scale=1, user-scalable=no
  • Name: mobile-web-app-capable
    Content: yes
  • Name: apple-mobile-web-app-capable
    Content: yes
  • Name: twitter:card
    Content: summary
  • Name: twitter:title
    Content: Vitor Torres
  • Name: twitter:image
    Content: http://vgatorres.com/wp-content/uploads/2015/12/as.png
  • Name: generator
    Content: WordPress 4.5.4

Server / Hosting

  • IP: 107.180.51.106
  • Latitude: 33.61
  • Longitude: -111.89
  • Country: United States
  • City: Scottsdale

Rname

  • ns09.domaincontrol.com
  • ns10.domaincontrol.com
  • mail.vgatorres.com

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sat, 10 Sep 2016 16:50:58 GMT Server: Apache/2.4.23 X-Powered-By: PHP/5.5.37 X-Pingback: http://vgatorres.com/xmlrpc.php Location: http://vgatorres.com/ Vary: User-Agent Content-Length: 0 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1011 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Date: Sat, 10 Sep 2016 16:50:59 GMT Server: Apache/2.4.23 X-Powered-By: PHP/5.5.37 X-Pingback: http://vgatorres.com/xmlrpc.php Link: ; rel="https://api.w.org/", ; rel=shortlink Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1011 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

DNS

host: vgatorres.com
  1. class: IN
  2. ttl: 599
  3. type: A
  4. ip: 107.180.51.106
host: vgatorres.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns09.domaincontrol.com
host: vgatorres.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns10.domaincontrol.com
host: vgatorres.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns09.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016050200
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: vgatorres.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: mail.vgatorres.com
host: vgatorres.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 a mx ptr include:secureserver.net ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.gatorres.com, www.vygatorres.com, www.ygatorres.com, www.vzgatorres.com, www.zgatorres.com, www.vhgatorres.com, www.hgatorres.com, www.vngatorres.com, www.ngatorres.com, www.vmgatorres.com, www.mgatorres.com, www.vjgatorres.com, www.jgatorres.com, www.vkgatorres.com, www.kgatorres.com, www.vigatorres.com, www.igatorres.com, www.vatorres.com, www.vgsatorres.com, www.vsatorres.com, www.vgxatorres.com, www.vxatorres.com, www.vgyatorres.com, www.vyatorres.com, www.vghatorres.com, www.vhatorres.com, www.vgnatorres.com, www.vnatorres.com, www.vgcatorres.com, www.vcatorres.com, www.vgdatorres.com, www.vdatorres.com, www.vgeatorres.com, www.veatorres.com, www.vgratorres.com, www.vratorres.com, www.vgtatorres.com, www.vtatorres.com, www.vgbatorres.com, www.vbatorres.com, www.vgvatorres.com, www.vvatorres.com, www.vgtorres.com, www.vgaotorres.com, www.vgotorres.com, www.vgaptorres.com, www.vgptorres.com, www.vga9torres.com, www.vg9torres.com, www.vgatorres.com, www.vgtorres.com, www.vgaitorres.com, www.vgitorres.com, www.vgautorres.com, www.vgutorres.com, www.vgaorres.com, www.vgatqorres.com, www.vgaqorres.com, www.vgataorres.com, www.vgaaorres.com, www.vgat orres.com, www.vga orres.com, www.vgatworres.com, www.vgaworres.com, www.vgateorres.com, www.vgaeorres.com, www.vgatzorres.com, www.vgazorres.com, www.vgatxorres.com, www.vgaxorres.com, www.vgatcorres.com, www.vgacorres.com, www.vgatrres.com, www.vgatobrres.com, www.vgatbrres.com, www.vgatohrres.com, www.vgathrres.com, www.vgatogrres.com, www.vgatgrres.com, www.vgatojrres.com, www.vgatjrres.com, www.vgatomrres.com, www.vgatmrres.com, www.vgato rres.com, www.vgat rres.com, www.vgatovrres.com, www.vgatvrres.com, www.vgatores.com, www.vgatorires.com, www.vgatoires.com, www.vgatorores.com, www.vgatoores.com, www.vgatorlres.com, www.vgatolres.com, www.vgatorlres.com, www.vgatolres.com, www.vgator.res.com, www.vgato.res.com, www.vgatores.com, www.vgatorries.com, www.vgatories.com, www.vgatorroes.com, www.vgatoroes.com, www.vgatorrles.com, www.vgatorles.com, www.vgatorrles.com, www.vgatorles.com, www.vgatorr.es.com, www.vgator.es.com, www.vgatorrs.com, www.vgatorrexs.com, www.vgatorrxs.com, www.vgatorress.com, www.vgatorrss.com, www.vgatorrews.com, www.vgatorrws.com, www.vgatorrers.com, www.vgatorrrs.com, www.vgatorrefs.com, www.vgatorrfs.com, www.vgatorrevs.com, www.vgatorrvs.com, www.vgatorrecs.com, www.vgatorrcs.com, www.vgatorreqs.com, www.vgatorrqs.com, www.vgatorreas.com, www.vgatorras.com, www.vgatorreys.com, www.vgatorrys.com, www.vgatorre.com, www.vgatorrese.com, www.vgatorree.com, www.vgatorresw.com, www.vgatorrew.com, www.vgatorresd.com, www.vgatorred.com, www.vgatorresx.com, www.vgatorrex.com, www.vgatorresf.com, www.vgatorref.com, www.vgatorresg.com, www.vgatorreg.com, www.vgatorrest.com, www.vgatorret.com,

Other websites we recently analyzed

  1. Teleskope und Zubehör | Wolfgang Lille – Spezialist für SONNE – Verkauf und Beratung
    Berlin (Germany) - 81.169.145.66
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Flexslider, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 8
    Number of meta tags: 3
  2. hrprofession.co
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. Easton Sports Group
    Houston (United States) - 192.185.138.32
    Server software: nginx/1.10.0
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Pingback, Wordpress
    Number of Javascript: 11
    Number of meta tags: 2
  4. meada.com
    Switzerland - 141.8.224.25
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  5. melonella.com
    Dublin (Ireland) - 46.137.111.230
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: Html
  6. Klettertreff.org
    Herzfond
    Austria - 84.116.32.65
    Server software: Apache
    Technology: Html
    Number of meta tags: 4
  7. kasimpasalikemalefendivakfi.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
    Cyprus - 93.89.226.17
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html
  8. www.aarhusdesignbureau.dk
    Denmark - 77.66.85.131
    Server software: Apache-Coyote/1.1
    Technology: Html
    Number of meta tags: 1
  9. CNC-Bertschinger AG - Präzisionsmechanik
    Jules Bertschinger AG, Präzisionsmechanik, CNC-Bearbeitung, Werkzeug- und Formenbau
    Switzerland - 217.196.177.100
    Server software: nginx
    Technology: Html, Javascript, jQuery UI, Php, Xoops
    Number of Javascript: 9
    Number of meta tags: 8
  10. Riverside Haj
    Riverside Haj
    San Francisco (United States) - 192.241.212.155
    G Analytics ID: UA-51322866-1
    Server software: nginx/1.4.6 (Ubuntu)
    Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, jQuery, Google Analytics
    Number of Javascript: 13
    Number of meta tags: 5

Check Other Websites